PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400020563
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GATA
Protein Properties Length: 279aa    MW: 30654.6 Da    PI: 7.732
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400020563genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA61.69.5e-20195229135
                  GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                           C++Cg+ kTp+WR gp g+ktLCnaCG++y++ +l
  PGSC0003DMP400020563 195 CQHCGADKTPQWRAGPLGPKTLCNACGVRYKSGRL 229
                           *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.136189225IPR000679Zinc finger, GATA-type
SMARTSM004018.8E-16189239IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.71E-15191252No hitNo description
Gene3DG3DSA:3.30.50.101.0E-14192227IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.60E-14194242No hitNo description
PROSITE patternPS003440195220IPR000679Zinc finger, GATA-type
PfamPF003202.3E-17195229IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MKMEDLDPTA CFMVDDDLLN FSLEDETVEE DDEKSTITSK DPLSYSSSSS TNPLVSLLPH  60
PECVEEELEW LSNKDAFPAI EFGILSENPG MVFDHHSPVS VLENSSSTSH SSGNGVVNGN  120
AYTSCCVNLK VPVNYPVRAR SKRRRRRRRG GFANMPSEHC LPVTQPSFKN VKQHEPLLSL  180
PMNSAKSAAS IGRRCQHCGA DKTPQWRAGP LGPKTLCNAC GVRYKSGRLL PEYRPANSPS  240
FSAAAHSNSH RKVLEMRKHK IGVGGMLIHE ACGYRVEQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139148RSKRRRRRRR
2141146KRRRRR
3142148RRRRRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755210.0HG975521.1 Solanum lycopersicum chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006340920.10.0PREDICTED: GATA transcription factor 1-like
TrEMBLM1ATZ40.0M1ATZ4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000302740.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA40762445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.18e-41GATA transcription factor 1
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]